.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b4b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
    Site NYSGXRC
    PDB Id 2b4b Target Id NYSGXRC-9502a
    Related PDB Ids 2b3u 2b58 2b5g 2b4d 2b3v 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7848,NP_00296, PF00583 Molecular Weight 20022.95 Da.
    Residues 171 Isoelectric Point 5.09
    Sequence makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.265
    Matthews' coefficent 2.14 Rfactor 0.226
    Waters 83 Solvent Content 42.47

    Ligand Information
    Ligands COA (COENZYME) x 2;B33 (N-ETHYL-N-[3-(PROPYLAMINO)PROPYL]PROPANE-1,3-DIAMINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2b4b
    1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
    MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences
     
    2. Mechanistic and structural analysis of human spermidine/spermine N 1-acetyltransferase
    SS Hegde, J Chandler, MW Vetting, M Yu - Biochemistry, 2007 - ACS Publications
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. The Crystal Structure of Spermidine/Spermine N 1-Acetyltransferase in Complex with Spermine Provides Insights into Substrate Binding and Catalysis,
    EJ Montemayor, DW Hoffman - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch