.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b0a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein Mj0783 from Methanococcus Jannaschii. To be Published
    Site NYSGXRC
    PDB Id 2b0a Target Id NYSGXRC-T1168
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8157,Q58193 Molecular Weight 21236.63 Da.
    Residues 186 Isoelectric Point 5.25
    Sequence meildltqtlinfpypgdpelriiekkidgfivseiimgshlcthidypkhvglenripfkdgiikgkg ycislddfernklpacdilliytgfskywgrdeyfekipeipflddiiksnikcvgidactiggfeehk rllsnniliienlnenlknlvgksfyflglplkifdidaspirciail
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.21823
    Matthews' coefficent 2.46 Rfactor 0.18505
    Waters 126 Solvent Content 45.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b0a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch