.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a1f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uridylate kinase. To be Published
    Site NYSGXRC
    PDB Id 2a1f Target Id NYSGXRC-T1637
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8209,16272996 Molecular Weight 26933.79 Da.
    Residues 247 Isoelectric Point 6.24
    Sequence mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrgaklakag mnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaikmlrekrvvifsagtg npffttdstaclrgieieadvvlkatkvdgvydcdpaknpdaklyknlsyaevidkelkvmdlsaftla rdhgmpirvfnmgkpgalrqvvtgteegtticeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.26327
    Matthews' coefficent 2.99 Rfactor 0.21031
    Waters 889 Solvent Content 58.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a1f
    1. Structural and enzymatic investigation of the Sulfolobus solfataricus uridylate kinase shows competitive UTP inhibition and the lack of GTP stimulation
    KS Jensen, E Johansson, KF Jensen - Biochemistry, 2007 - ACS Publications
     
    2. The Crystal Structure of UMP Kinase from Bacillus anthracis(BA1797) Reveals an Allosteric Nucleotide-Binding Site
    C Meier, LG Carter, S Sainsbury, EJ Mancini - Journal of molecular , 2008 - Elsevier
     
    3. Unique GTP-binding pocket and allostery of uridylate kinase from a gram-negative phytopathogenic bacterium
    JL Tu, KH Chin, AHJ Wang, SH Chou - Journal of molecular biology, 2009 - Elsevier
     
    4. Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation
    G Labesse, K Benkali, I Salard-Arnaud - Nucleic acids , 2011 - Oxford Univ Press
     
    5. Structural and functional studies of enzymes in nucleotide metabolism
    L Egeblad - 2011 - pub.epsilon.slu.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch