.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zwl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide. Protein Sci. 14 3004-3012 2005
    Site NYSGXRC
    PDB Id 1zwl Target Id NYSGXRC-T1781
    Related PDB Ids 1zwk 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8242,15596146 Molecular Weight 22410.20 Da.
    Residues 213 Isoelectric Point 6.48
    Sequence mghhhhhhgghmslsspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipa egalyatledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqett qlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcralgkrlaetag kleggs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.23594
    Matthews' coefficent 2.81 Rfactor 0.19693
    Waters 34 Solvent Content 55.86

    Ligand Information
    Ligands FMN (FLAVIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zwl
    1. Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide
    J Gorman, L Shapiro - Protein science, 2005 - Wiley Online Library
     
    2. Crystal structure of the NADH: quinone oxidoreductase WrbA from Escherichia coli
    SLA Andrade, EV Patridge, JG Ferry - Journal of , 2007 - Am Soc Microbiol
     
    3. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    4. Crystallization and preliminary diffraction analysis of Escherichia coli WrbA in complex with its cofactor flavin mononucleotide
    J Wolfov, JR Mesters, J Brynda, R Grandori - Section F: Structural , 2007 - scripts.iucr.org
     
    5. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch