.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide. Protein Sci. 14 3004-3012 2005
    Site NYSGXRC
    PDB Id 1zwk Target Id NYSGXRC-T1781
    Related PDB Ids 1zwl 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8241,15596146 Molecular Weight 22410.20 Da.
    Residues 213 Isoelectric Point 6.48
    Sequence mghhhhhhgghmslsspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipa egalyatledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqett qlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcralgkrlaetag kleggs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2731
    Matthews' coefficent 3.02 Rfactor 0.22621
    Waters 51 Solvent Content 58.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1zwk
    1. Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide
    J Gorman, L Shapiro - Protein science, 2005 - Wiley Online Library
     
    2. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch