The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Agrobacterium Tumefaciens Malate Dehydrogenase. To be Published
    Site NYSGXRC
    PDB Id 1z2i Target Id NYSGXRC-T1173
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8158,Q8UB09 Molecular Weight 38250.23 Da.
    Residues 358 Isoelectric Point 5.62
    Sequence mahgnekatvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllahyvtaleggr lnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavairnsshfgpagayaleaar qgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpwlldmatsavpynrvllyrslgqqlpqg vasdgdgvdtrdpnavemlapvggefgfkgaalagvveifsavltgmrlsfdlapmggpdfstprglga fvlalkpeaflerdvfdesmkrylevlrgsparedckvmapgdrewavaakreregapvdpvtraafse laekfsvspptyh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.265
    Matthews' coefficent 2.67 Rfactor 0.239
    Waters 699 Solvent Content 53.50

    Ligand Information


    Google Scholar output for 1z2i

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch