.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yzy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Haemophilus Influenzae Hypothetical Protein HI1011. To be Published
    Site NYSGXRC
    PDB Id 1yzy Target Id NYSGXRC-T1163
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8156,P44093 Molecular Weight 44784.59 Da.
    Residues 413 Isoelectric Point 5.13
    Sequence mlgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaieqslrayqwl kengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngrtifngylfvgdvllsesg mknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvqecfaelkaqgyryavvdavdnsqlevl aeavadfklvtggsglgaymaarlsggkkgtnaftptkgktvvlsgscsvmtnkqvekyrekaphfqld veqaihnenyieqlyqwvianldsefapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqy gvtnfitaggetssivvqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.245
    Matthews' coefficent 2.48 Rfactor 0.213
    Waters 389 Solvent Content 49.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yzy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch