.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yt8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thiosulfate sulfurtransferase from Pseudomonas aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 1yt8 Target Id NYSGXRC-T1653
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS8214,15597799 Molecular Weight 58635.55 Da.
    Residues 539 Isoelectric Point 5.45
    Sequence mslsqiavrtfhdiraallarrelalldvreedpfaqahplfaanlplsrleleiharvprrdtpitvy ddgeglapvaaqrlldlgysdvalldgglsgwrnaggelfrdvnvpskafgelveaerhtpslaaeevq alldaraeavildarrfdeyqtmsipggisvpgaelvlrvaelapdprtrvivncagrtrsiigtqsll nagipnpvaalrngtigwtlagqqlehgqtrrfgaisqdtrkaaaqraravadragverldlaglaqwq dehdrttylldvrtpeeyeaghlpgsrstpggqlvqetdhvasvrgarlvlvdddgvranmsaswlaqm gwqvavldglseadfsergawsaplprqpradtidpttladwlgepgtrvldftasanyakrhipgaaw vlrsqlkqalerlgtaeryvltcgssllarfavaevqalsgkpvflldggtsawvaaglptedgeslla spridryrrpyegtdnpreamqgyldwefglveqlgrdgthgffvieggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.209
    Matthews' coefficent 2.70 Rfactor 0.185
    Waters 524 Solvent Content 55.00

    Ligand Information
    Ligands SO3 (SULFITE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yt8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch