.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yif

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF beta-1,4-xylosidase FROM BACILLUS SUBTILIS. To be Published
    Site NYSGXRC
    PDB Id 1yif Target Id NYSGXRC-T2062
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS8267,16078821 Molecular Weight 61332.60 Da.
    Residues 533 Isoelectric Point 5.42
    Sequence mkitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsqldmkgnpns ggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepiklnssgfdaslfhdtdgkk yllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtdrklteaphlyhignyyylltaeggtr yehaatiarsaniegpyevhpdnpiltswhdpgnplqkcghasivqthtdewylahltgrpihpdddsi fqqrgycplgretaiqklywkdewpyvvggkegslevdapsipetifeatypevdefedstlninfqtl ripftnelgsltqapnhlrlfghesltstftqafvarrwqslhfeaetavefypenfqqaaglvnyynt enwtalqvthdeelgrilelticdnfsfsqplnnkiviprevkyvylrvniekdkyyyfysfnkedwhk idialeskklsddyirgggfftgafvgmqcqdtggnhipadfryfrykek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.218
    Matthews' coefficent 2.41 Rfactor 0.205
    Waters 2728 Solvent Content 48.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yif
    1. Structural and functional insights into the B30. 2/SPRY domain
    JS Woo, JH Imm, CK Min, KJ Kim, SS Cha, BH Oh - The EMBO journal, 2006 - nature.com
     
    2. Structure of the PRYSPRY-domain: implications for autoinflammatory diseases
    C Grtter, C Briand, G Capitani, PRE Mittl, S Papin - FEBS letters, 2006 - Elsevier
     
    3. The Structure of an Inverting GH43 [beta]-Xylosidase from Geobacillus stearothermophilus with its Substrate Reveals the Role of the Three Catalytic Residues
    C Brx, A Ben-David, D Shallom-Shezifi, M Leon - Journal of molecular , 2006 - Elsevier
     
    4. Structure-function relationships of a catalytically efficient _-D-xylosidase
    DB Jordan, XL Li, CA Dunlap, TR Whitehead - Applied biochemistry , 2007 - Springer
     
    5. Active protein aggregates induced by terminally attached self-assembling peptide ELK16 in Escherichia coli
    W Wu, L Xing, B Zhou, Z Lin - Microb Cell Fact, 2011 - biomedcentral.com
     
    6. Crystal structure of scytalidoglutamic peptidase with its first potent inhibitor provides insights into substrate specificity and catalysis
    B Pillai, MM Cherney, K Hiraga, K Takada - Journal of molecular , 2007 - Elsevier
     
    7. Purification, crystallization and preliminary X-ray analysis of a thermostable glycoside hydrolase family 43-xylosidase from Geobacillus thermoleovorans IT-08
    A Rohman, N Van Oosterwijk, S Kralj - Section F: Structural , 2007 - scripts.iucr.org
     
    8. X-ray crystallographic native sulfur SAD structure determination of laminarinase Lam16A from Phanerochaete chrysosporium
    J Vasur, R Kawai, AM Larsson, K Igarashi - Section D: Biological , 2006 - scripts.iucr.org
     
    9. Crystallization and preliminary crystallographic analysis of a family 43 _-d-xylosidase from Geobacillus stearothermophilus T-6
    C Brx, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - ncbi.nlm.nih.gov
     
    10. The Structure of an Inverting GH43 b-Xylosidase from Geobacillus stearothermophilus with its Substrate Reveals the Role of the Three Catalytic Residues
    K Niefind, G Shoham, Y Shoham, D Schomburg - J. Mol. Biol, 2006 - biotech.technion.ac.il
     
    11. Crystallization and preliminary crystallographic analysis of a family 43-D-xylosidase from Geobacillus stearothermophilus T-6
    C Brux, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - scripts.iucr.org
     
    12. Structural Biology of Post-translational Modifications of Proteins
    ____ - YAKUGAKU ZASSHI, 2012 - J-STAGE
     
    13. ___________________
    ____ - ____, 2012 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch