.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Gfo/Idh/MocA family oxidoreductase from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 1xea Target Id NYSGXRC-T1536
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8191,15601799 Molecular Weight 36572.70 Da.
    Residues 323 Isoelectric Point 6.24
    Sequence mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlqygvdavmi haatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgfnrrhiplynqhlselaq qecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcnlddlhltyhmsegllarldvqwqtg dtllhasmnrqfgittehvtasydnvaylfdsftqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwl qvaaagklpthiiernlashqlaeaicqqitqqvtkgeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.65 Rfree 0.271
    Matthews' coefficent 2.85 Rfactor 0.227
    Waters 273 Solvent Content 55.50

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 1xea
    1. Protein structure similarity clustering: dynamic treatment of PDB
    BD Charette, RG MacDonald, S Wetzel - Angewandte Chemie , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch