.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative phosphatase from Streptococcus mutans UA159. To be Published
    Site NYSGXRC
    PDB Id 1wvi Target Id NYSGXRC-T1939
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS8257,24379818 Molecular Weight 28386.25 Da.
    Residues 257 Isoelectric Point 5.16
    Sequence mtykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfniktpleti ytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgldtnltyekltlatlaiqk gavfigtnpdlniptergllpgagailfllekatrvkpiiigkpeavimnkaldrlgvkrheaimvgdn yltditagikndiatllvttgftkpeevpalpiqpdfvlsslaewdfder
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.44 Rfactor 0.248
    Waters Solvent Content 47.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wvi
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     
    3. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch