.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thiamine biosynthesis protein from Pseudomonas Aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 1wv2 Target Id NYSGXRC-T1779
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8240,15595578 Molecular Weight 29586.35 Da.
    Residues 277 Isoelectric Point 5.46
    Sequence mslsqasstdtpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnigqnpdepnlld vippdrytilpntagcydaveavrtcrlarelldghnlvklevladqktlfpnvvetlkaaeqlvkdgf dvmvytsddpiiarqlaeigciavmplagligsglgicnpynlriileeakvpvlvdagvgtasdaaia melgceavlmntaiahakdpvmmaeamkhaivagrlaylagrmprklyasasspldglideggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.304
    Matthews' coefficent 2.21 Rfactor 0.254
    Waters Solvent Content 42.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wv2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch