.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wuf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein GI:16801725, member of Enolase superfamily from Listeria innocua. To be Published
    Site NYSGXRC
    PDB Id 1wuf Target Id NYSGXRC-T2186
    Molecular Characteristics
    Source Listeria innocua clip11262 gi 16415200 emb cac97890.1 lin2664
    Alias Ids TPS8275,16801725 Molecular Weight 44404.87 Da.
    Residues 393 Isoelectric Point 6.49
    Sequence ghhhhhhhhhhglvprgshmyfqkarlihaelpllapfktsygelkskdfyiielineegihgygelea fplpdyteetlssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrs lakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrksfpklslma dansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricldenirsvkdveqahsigsc rainlklarvggmssalkiaeycalneilvwcggmleagvgrahnialaarnefvfpgdisasnrffae divtpafelnqgrlkvptnegigvtldlkvlkkytksteeillnkgws
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.274
    Matthews' coefficent 2.17 Rfactor 0.236
    Waters Solvent Content 41.20

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1wuf
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch