.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u6m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of acetyltransferase, GNAT family from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 1u6m Target Id NYSGXRC-T1628
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8208,29375529 Molecular Weight 22358.22 Da.
    Residues 199 Isoelectric Point 5.17
    Sequence mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilvyehageva giavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvderfrgmgigsklldalp evakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghlynhmqkeveggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.24676
    Matthews' coefficent 69.92 Rfactor 0.20332
    Waters 609 Solvent Content 4.12

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1u6m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch