The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of conserved hypothetical protein. To be Published
    Site NYSGXRC
    PDB Id 1tsj Target Id NYSGXRC-T1626
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus
    Alias Ids TPS8207,21282819 Molecular Weight 16211.61 Da.
    Residues 145 Isoelectric Point 4.96
    Sequence msldipkittflmfnnqaeeavklytslfedseiitmakygengpgdpgtvqhsiftlngqvfmaidan sgtelpmnpaislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfgvsfqlalpeegg shhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.26377
    Matthews' coefficent 2.86 Rfactor 0.18905
    Waters 22 Solvent Content 56.73

    Ligand Information


    Google Scholar output for 1tsj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch