.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tr9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of beta-hexosaminidase from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 1tr9 Target Id NYSGXRC-T1608
    Related PDB Ids 1y65 
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8202,15640711, 60594517 Molecular Weight 37817.06 Da.
    Residues 342 Isoelectric Point 5.64
    Sequence mslgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpiligvdqeggr vqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldmgfackaignrafgedv qtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyderetiaqdmaifraqieagvldammp ahvvyphydaqpasgssywlkqvlreelgfkgivfsddlsmegaavmggpvershqalvagcdmilicn kreaavevldnlpimevpqaeallkkqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.20314
    Matthews' coefficent 2.35 Rfactor 0.17015
    Waters 277 Solvent Content 47.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tr9
    1. A novel variant of Thermotoga neapolitana _-glucosidase B is an efficient catalyst for the synthesis of alkyl glucosides by transglycosylation
    P Turner, D Svensson, P Adlercreutz - Journal of biotechnology, 2007 - Elsevier
     
    2. Structural rationale for low-nanomolar binding of transition state mimics to a family GH3 _-D-glucan glucohydrolase from barley
    M Hrmova, VA Streltsov, BJ Smith, A Vasella - Biochemistry, 2005 - ACS Publications
     
    3. Structural and Functional Analyses of [beta]-Glucosidase 3B from Thermotoga neapolitana: A Thermostable Three-Domain Representative of Glycoside Hydrolase 3
    T Pozzo, JL Pasten, EN Karlsson, DT Logan - Journal of molecular biology, 2010 - Elsevier
     
    4. Dissecting the catalytic mechanism of a plant [beta]-d-glucan glucohydrolase through structural biology using inhibitors and substrate analogues
    M Hrmova, GB Fincher - Carbohydrate research, 2007 - Elsevier
     
    5. Identification, characterization, and regulation of a novel antifungal chitosanase gene (cho) in Anabaena spp.
    V Gupta, R Prasanna, C Natarajan - Applied and , 2010 - Am Soc Microbiol
     
    6. Structural insights into the _-xylosidase from Trichoderma reesei obtained by synchrotron small-angle X-ray scattering and circular dichroism spectroscopy
    AL Rojas, H Fischer, EV Eneiskaya - Biochemistry, 2005 - ACS Publications
     
    7. Expression, purification, crystallization and preliminary X-ray diffraction analysis of Thermotoga neapolitana-glucosidase B
    P Turner, A Pramhed, E Kanders - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch