.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tlt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Putative Oxidoreductase (VIRULENCE FACTOR mviM HOMOLOG). To be Published
    Site NYSGXRC
    PDB Id 1tlt Target Id NYSGXRC-T1535
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8190,16129031 Molecular Weight 35033.03 Da.
    Residues 319 Isoelectric Point 6.78
    Sequence mslkklrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaascdav fvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfnrrfaplygelktql ataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldggtlltndagemlfaehhfsag plqittcmhrragsqretvqavtdgaliditdmrewreergqgvvhkpipgwqstleqrgfvgcarhfi ecvqnqtvpqtageqavlaqrivdkiwrdamseeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.294
    Matthews' coefficent 3.68 Rfactor 0.245
    Waters 36 Solvent Content 66.31

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1tlt
    1. Crystal structure of NADP (H)-dependent 1, 5-anhydro-D-fructose reductase from Sinorhizobium morelense at 2.2 resolution: construction of a NADH-accepting
    TR Dambe, AM Khn, T Brossette, F Giffhorn - Biochemistry, 2006 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch