.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein Yvdd - Putative Lysine Decarboxylase. To be Published
    Site NYSGXRC
    PDB Id 1t35 Target Id NYSGXRC-T833
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8145,O06986 Molecular Weight 21053.16 Da.
    Residues 191 Isoelectric Point 5.25
    Sequence mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggtaigvmpsglf sgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcwaqigihqkpiglynvngy fepmmkmvkysiqegfsneshlklihsssrpdelieqmqnysypilekkwtei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.72 Rfree 0.286
    Matthews' coefficent 2.67 Rfactor 0.243
    Waters 45 Solvent Content 53.63

    Ligand Information
    Ligands SO4 (SULFATE) x 14
    Metals

    Jmol

     
    Google Scholar output for 1t35
    1. Combining specificity determining and conserved residues improves functional site prediction
    O Kalinina, M Gelfand, R Russell - BMC bioinformatics, 2009 - biomedcentral.com
     
    2. The Crystal Structure of the Pseudomonas dacunhae Aspartate-[beta]-Decarboxylase Dodecamer Reveals an Unknown Oligomeric Assembly for a Pyridoxal-5'-
    S Lima, B Sundararaju, C Huang, R Khristoforov - Journal of molecular , 2009 - Elsevier
     
    3. X_ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210
    WB Jeon, S Allard, CA Bingman, E Bitto - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8
    M Kukimoto_Niino, K Murayama - Protein , 2004 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch