.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sgm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative HTH-type transcriptional regulator yxaF from Bacillus subtilis. Proteins 63 1087-1091 2006
    Site NYSGXRC
    PDB Id 1sgm Target Id NYSGXRC-T1414
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8161,P42105 Molecular Weight 21018.11 Da.
    Residues 191 Isoelectric Point 6.12
    Sequence mtsrgdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgkivehl iqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvcmkvfksweavfark lmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqipvlvrkkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.294
    Matthews' coefficent 2.18 Rfactor 0.233
    Waters 236 Solvent Content 43.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sgm
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     
    3. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    4. Detecting DNA-binding helixturnhelix structural motifs using sequence and structure information
    M Pellegrini-Calace, JM Thornton - Nucleic acids research, 2005 - Oxford Univ Press
     
    5. Crystal structure of a putative HTH_type transcriptional regulator yxaF from Bacillus subtilis
    J Seetharaman, D Kumaran - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    7. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    8. Approximate Search on Protein Structures for Identification of Horizontal Gene Transfer in Bacteria
    S Billa, MA Griep, PZ Revesz - Ninth Symposium of Abstraction, , 2011 - aaai.org
     
    9. Protein StructureBased Method for Identification of Horizontal Gene Transfer in Bacteria
    S Billa - 2011 - digitalcommons.unl.edu
     
    10. Identification of Aromatic Residues Critical to the DNA Binding and Ligand Response of the Bacillus subtilis QdoR (YxaF) Repressor Antagonized by Flavonoids
    K Hirooka, Y Fujita - Bioscience, biotechnology, and biochemistry, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch