.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s80

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of serine acetyltransferase from Haemophilus influenzae Rd. Acta Crystallogr.,Sect.D 60 1600-1605 2004
    Site NYSGXRC
    PDB Id 1s80 Target Id NYSGXRC-T789
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8132,52695446, 16272548 Molecular Weight 30405.06 Da.
    Residues 278 Isoelectric Point 6.22
    Sequence msltldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislreiieeay qsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqnrkslalylqnqisvaf dvdihpaakighgimfdhatgivvgetsviendvsilqgvtlggtgkesgdrhpkvregvmigagakil gnievgkyakigansvvlnpvpeyataagvparivsqdkaakpafdmnqyfigiddgmnlneggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.21913
    Matthews' coefficent 3.00 Rfactor 0.17155
    Waters 418 Solvent Content 58.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s80
    1. Functional analysis of the cysteine synthase protein complex from plants: structural, biochemical and regulatory properties
    M Wirtz, R Hell - Journal of plant physiology, 2006 - Elsevier
     
    2. A mechanistic model of the cysteine synthase complex
    A Feldman-Salit, M Wirtz, R Hell, RC Wade - Journal of molecular biology, 2009 - Elsevier
     
    3. Structure of serine acetyltransferase from Haemophilus influenzae Rd
    J Gorman, L Shapiro - Acta Crystallographica Section D: Biological , 2004 - scripts.iucr.org
     
    4. Sequence analysis and structure prediction of type II Pseudomonas sp. USM 455 PHA synthase and an insight into its catalytic mechanism
    H Wahab, NA Khairudin, M Samian - BMC structural , 2006 - biomedcentral.com
     
    5. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch