.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rrm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Lactaldehyde reductase. To be Published
    Site NYSGXRC
    PDB Id 1rrm Target Id NYSGXRC-T1407
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8160,P11549 Molecular Weight 40642.31 Da.
    Residues 383 Isoelectric Point 5.10
    Sequence mmanrmilnetawfgrgavgaltdevkrrgyqkalivtdktlvqcgvvakvtdkmdaaglawaiydgvv pnptitvvkeglgvfqnsgadyliaigggspqdtckaigiisnnpefadvrsleglsptnkpsvpilai pttagtaaevtinyvitdeekrrkfvcvdphdipqvafidadmmdgmppalkaatgvdalthaiegyit rgawaltdalhikaieiiagalrgsvagdkdageemalgqyvagmgfsnvglglvhgmahplgafyntp hgvanaillphvmrynadftgekyrdiarvmgvkvegmsleearnaaveavfalnrdvgipphlrdvgv rkedipalaqaalddvctggnpreatledivelyhtaw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.211
    Matthews' coefficent 2.31 Rfactor 0.193
    Waters 670 Solvent Content 46.70

    Ligand Information
    Ligands APR (ADENOSINE-5-DIPHOSPHORIBOSE) x 2;PGO (S-1,2-PROPANEDIOL) x 2
    Metals ZN (ZINC) x 2;FE2 (FE) x 2

    Jmol

     
    Google Scholar output for 1rrm
    1. Improved segmental isotope labeling methods for the NMR study of multidomain or large proteins: application to the RRMs of Npl3p and hnRNP L
    L Skrisovska, FHT Allain - Journal of molecular biology, 2008 - Elsevier
     
    2. S-nitrosylation of Drp1 links excessive mitochondrial fission to neuronal injury in neurodegeneration
    T Nakamura, P Cieplak, DH Cho, A Godzik, SA Lipton - Mitochondrion, 2010 - Elsevier
     
    3. 1, 3-propanediol dehydrogenase from Klebsiella pneumoniae: decameric quaternary structure and possible subunit cooperativity
    D Maral, AT Rgo, MA Carrondo - Journal of , 2009 - Am Soc Microbiol
     
    4. Relaxing the coenzyme specificity of 1, 3-propanediol oxidoreductase from Klebsiella pneumoniae by rational design
    C Ma, L Zhang, J Dai, Z Xiu - Journal of biotechnology, 2010 - Elsevier
     
    5. Functional characterization of a stereospecific diol dehydrogenase, FucO, from Escherichia coli: Substrate specificity, pH dependence, kinetic isotope effects
    C Blikstad, M Widersten - Journal of Molecular Catalysis B: Enzymatic, 2010 - Elsevier
     
    6. N-Terminal Gly224Gly411 Domain in Listeria Adhesion Protein Interacts with Host Receptor Hsp60
    B Jagadeesan, AEF Littlejohn, MAR Amalaradjou - PloS one, 2011 - dx.plos.org
     
    7. Structures of iron-dependent alcohol dehydrogenase 2 from Zymomonas mobilis ZM4 with and without NAD+ cofactor
    JH Moon, HJ Lee, SY Park, JM Song, MY Park - Journal of Molecular , 2011 - Elsevier
     
    8. Enzymes as catalysts in organic synthesis: Expression, characterisation and directed evolution of a propanediol oxidoreductase from E. coli
    C Blikstad - 2008 - biorg.uu.se
     
    9. Manipulation of the pH dependence of the propanediol dehydrogenase, FucO, catalyzed alcohol oxidation
    C Blikstad - 2009 - biorg.uu.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch