.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ri6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative 7-bladed propeller isomerase. To be Published
    Site NYSGXRC
    PDB Id 1ri6 Target Id NYSGXRC-T1479
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8174,16128735 Molecular Weight 37675.21 Da.
    Residues 343 Isoelectric Point 5.36
    Sequence mslkqtvyiaspesqqihvwnlnhegaltltqvvdvpgqvqpmvvspdkrylyvgvrpefrvlayriap ddgaltfaaesalpgslthistdhqgqfvfvgsynagnvsvtrledglpvgvvdvvegldgchsanisp dnrtlwvpalkqdriclftvsddghlvaqdpaevttvegagprhmvfhpneqyaycvnelnssvdvwel kdphgniecvqtldmmpenfsdtrwaadihitpdgrhlyacdrtaslitvfsvsedgsvlskegfqpte tqprgfnvdhsgkyliaagqkshhisvyeivgeqgllhekgryavgqgpmwvvvnaheggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.203
    Matthews' coefficent 2.10 Rfactor 0.168
    Waters 423 Solvent Content 41.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ri6
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    3. Analysis of and function predictions for previously conserved hypothetical or putative proteins in Blochmannia floridanus
    P Gaudermann, I Vogl, E Zientz, FJ Silva - Bmc , 2006 - biomedcentral.com
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. An automated procedure for detecting protein folds from sub-nanometer resolution electron density
    R Khayat, GC Lander, JE Johnson - Journal of structural biology, 2010 - Elsevier
     
    6. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    7. Cell surface proteins in archaeal and bacterial genomes comprising
    S Adindla, KK Inampudi, L Guruprasad - International journal of biological , 2007 - Elsevier
     
    8. The automatic detection of known _-propeller structural motifs from protein tertiary structure
    A Kotu, K Guruprasad - International journal of biological macromolecules, 2005 - Elsevier
     
    9. A network-based representation of protein fold space
    S Bliven - 2011 - acsweb.ucsd.edu
     
    10. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch