.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical transcriptional regulator ycdC from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 1pb6 Target Id NYSGXRC-T803
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8136,P75899 Molecular Weight 23686.29 Da.
    Residues 212 Isoelectric Point 8.92
    Sequence mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiav lrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkali deksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriiie girpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.277
    Matthews' coefficent 3.15 Rfactor 0.238
    Waters 160 Solvent Content 60.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pb6
    1. Crystal Structure of the TetR/CamR Family Repressor Mycobacterium tuberculosis EthR Implicated in Ethionamide Resistance
    LG Dover, PE Corsino, IR Daniels, SL Cocklin - Journal of molecular , 2004 - Elsevier
     
    2. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    3. Walking through the protein sequence space: Towards new generation of the homology modeling
    ZM Frenkel, EN Trifonov - PROTEINS: Structure, Function, and , 2007 - Wiley Online Library
     
    4. Crystal Structure of Bacillus cereus HlyIIR, a Transcriptional Regulator of the Gene for Pore-forming Toxin Hemolysin II
    OV Kovalevskiy, AA Lebedev, AK Surin - Journal of molecular , 2007 - Elsevier
     
    5. Unmet challenges of structural genomics
    M Chruszcz, M Domagalski, T Osinski - Current opinion in , 2010 - Elsevier
     
    6. Saccharomyces cerevisiae Hop1 protein zinc finger motif binds to the Holliday junction and distorts the DNA structure: implications for holliday junction migration
    P Tripathi, D Pal, K Muniyappa - Biochemistry, 2007 - ACS Publications
     
    7. The proteinDNA contacts in RutR carAB operator complexes
    PN Le Minh, I Bervoets, D Maes - Nucleic acids , 2010 - Oxford Univ Press
     
    8. X-ray crystallography: assessment and validation of protein-small molecule complexes for drug discovery
    DR Cooper, PJ Porebski - Expert Opinion on , 2011 - informahealthcare.com
     
    9. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    10. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    11. A CHEMICAL GROUP GRAPH REPRESENTATION FOR EFFICIENT HIGH-THROUGHPUT ANALYSIS OF ATOMISTIC PROTEIN SIMULATIONS
    NC BENSON, V DAGGETT - Journal of Bioinformatics and , 2012 - World Scientific
     
    12. Unmet challenges of structural genomics
    A Wlodawer, W Minor - Current Opinion in Structural Biology, 2010 - mcl1.ncifcrf.gov
     
    13. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    14. Multi-Scale Genetics towards Understanding the Hierarchy of Transcription Factor Network in Genome Regulation
    A Ishihama, H Ogasawara, T Shimada - and Human Science , 2006 - ieeexplore.ieee.org
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch