.
The Open Protein Structure Annotation Network
PDB Keyword
.

1la2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of Saccharomyces cerevisiae myo-inositol phosphate synthase. J.STRUCT.FUNCT.GENOM. 2 129-134 2002
    Site NYSGXRC
    PDB Id 1la2 Target Id NYSGXRC-T23
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8086,P11986 Molecular Weight 60066.49 Da.
    Residues 536 Isoelectric Point 6.12
    Sequence mtedniapitsvkrlvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldfekkpeklg imliglggnngstlvasvlankhnvefqtkakgvkqpnyfgsmtqcstlklgidaegndvyapfnsllp mvspkhfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypdfiaanqderanqcin ldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanteryvevspgvndtmenllqsikndhe eiapstifaaasilegvpyingspqntfvpglvqlaehegtfiagddlksgqtklksvlaqflvdagik pvsiasynhlgnndgynlsapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgds kvamdeyyselmlgghnrisihnvcedsllataliidllvmtefctrvsykkvdpvkedagkfenfypv ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.65 Rfree 0.28
    Matthews' coefficent 3.00 Rfactor 0.224
    Waters 692 Solvent Content 58.95

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1la2
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches
    BV Strokopytov, A Fedorov, NM Mahoney - Section D: Biological , 2005 - scripts.iucr.org
     
    3. Structural analysis of Saccharomyces cerevisiae myo-inositol phosphate synthase
    R Kniewel, JA Buglino, V Shen, T Chadha - Journal of Structural and , 2002 - Springer
     
    4. Evolutionary divergence of L-myo-inositol 1-phosphate synthase: Significance of a core catalytic structure
    KG Dastidar, A Chatterjee, A Chatterjee - Biology of Inositols and , 2006 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch