.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kag

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli shikimate kinase I (AroK) that confers sensitivity to mecillinam. Proteins 47 558-562 2002
    Site NYSGXRC
    PDB Id 1kag Target Id NYSGXRC-T535
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8112,P24167 Molecular Weight 19405.87 Da.
    Residues 172 Isoelectric Point 5.26
    Sequence aekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdreekvinel tekqgivlatgggsvksretrnrlsargvvvylettiekqlartqrdkkrpllhvetpprevlealane rnplyeeiadvtirtddqsakvvanqiihmlesn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.2710000
    Matthews' coefficent 1.97 Rfactor 0.2170000
    Waters 258 Solvent Content 37.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kag
    1. Robust, high-throughput solution structural analyses by small angle X-ray scattering (SAXS)
    GL Hura, AL Menon, M Hammel, RP Rambo - Nature , 2009 - nature.com
     
    2. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. Crystal structure of the Escherichia coli shikimate kinase I (AroK) that confers sensitivity to mecillinam
    MJ Romanowski, SK Burley - Proteins: Structure, Function, and , 2002 - Wiley Online Library
     
    4. Crystal structure of Mycobacterium tuberculosis shikimate kinase in complex with shikimic acid and an ATP analogue
    J Gan, Y Gu, Y Li, H Yan, X Ji - Biochemistry, 2006 - ACS Publications
     
    5. In silico characterization of Shikimate Kinase of Shigella flexneri: A potential drug target
    N Arora, AK Banerjee, USN Murty - Sciences: Computational Life , 2010 - Springer
     
    6. Structures of Helicobacter pylori Shikimate Kinase Reveal a Selective Inhibitor-Induced-Fit Mechanism
    WC Cheng, YF Chen, HJ Wang, KC Hsu, SC Lin - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch