.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics: a pipeline for providing structures for the biologist. Protein Sci. 11 723-738 2002
    Site NYSGXRC
    PDB Id 1jr7 Target Id NYSGXRC-T130
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8098,P76621 Molecular Weight 37358.53 Da.
    Residues 325 Isoelectric Point 5.77
    Sequence mnaltavqnnavdsgqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvak ilddlcanqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyyarf vvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpl arrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvp vpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2400000
    Matthews' coefficent 3.44 Rfactor 0.1930000
    Waters 320 Solvent Content 64.28

    Ligand Information
    Ligands
    Metals FE2 (FE) x 1

    Jmol

     
    Google Scholar output for 1jr7
    1. Fe (II)/_-ketoglutarate-dependent hydroxylases and related enzymes
    RP Hausinger - Critical reviews in biochemistry and , 2004 - informahealthcare.com
     
    2. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    3. Structural studies on 2-oxoglutarate oxygenases and related double-stranded _-helix fold proteins
    IJ Clifton, MA McDonough, D Ehrismann - Journal of inorganic , 2006 - Elsevier
     
    4. Crystal structure of the alkylsulfatase AtsK: insights into the catalytic mechanism of the Fe (II) _-ketoglutarate-dependent dioxygenase superfamily
    I Mller, A Kahnert, T Pape, GM Sheldrick - Biochemistry, 2004 - ACS Publications
     
    5. The structure at 2.4 A resolution of the protein from gene locus At3g21360, a putative FeII/2-oxoglutarate-dependent enzyme from Arabidopsis thaliana
    E Bitto, CA Bingman, STM Allard - Section F: Structural , 2005 - scripts.iucr.org
     
    6. A mixture of fortunes: the curious determination of the structure of Escherichia coli BL21 Gab protein
    B Lohkamp, D Dobritzsch - Acta Crystallographica Section D: , 2008 - scripts.iucr.org
     
    7. Cupin: A candidate molecular structure for the Nep1-like protein family
    A Cechin, M Sinigaglia, N Lemke - BMC plant , 2008 - biomedcentral.com
     
    8. Biochemie und Molekularbiologie 2003
    N Strter, T Maier, A Skerra, K Schrrle - Nachrichten aus der , 2004 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch