.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g62

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of ribosome anti-association factor IF6. Nat.Struct.Biol. 7 1156-1164 2000
    Site NYSGXRC
    PDB Id 1g62 Target Id NYSGXRC-P111-1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8079,Q12522 Molecular Weight 24136.94 Da.
    Residues 224 Isoelectric Point 4.66
    Sequence matrtqfensneigvfskltntyclvavggsenfysafeaelgdaipivhttiagtriigrmtagnrrg llvptqttdqelqhlrnslpdsvkiqrveerlsalgnviccndyvalvhpdidreteelisdvlgvevf rqtisgnilvgsycslsnqgglvhpqtsvqdqeelssllqvplvagtvnrgssvvgagmvvndylavtg ldttapelsviesifrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2500000
    Matthews' coefficent 2.81 Rfactor 0.1970000
    Waters Solvent Content 56.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1g62
    1. STANDARD TRANSLATION INITIATION IN EUKARYOTES is the process that leads to assembly of an 80S ribosome on an mRNA in which the initiation codon is base
    TV Pestova, JR Lorsch - Translational control in , 2007 - books.google.com
     
    2. The Shwachman-Bodian-Diamond syndrome protein mediates translational activation of ribosomes in yeast
    TF Menne, B Goyenechea, N Snchez-Puig - Nature , 2007 - nature.com
     
    3. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    4. Crystal structures of ribosome anti-association factor IF6
    CM Groft, R Beckmann, A Sali, SK Burley - Nature structural biology, 2000 - salilab.org
     
    5. Mechanism of eIF6-mediated inhibition of ribosomal subunit joining
    M Gartmann, M Blau, JP Armache, T Mielke - Journal of Biological , 2010 - ASBMB
     
    6. Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli
    A Tocilj, JD Schrag, Y Li, BL Schneider - Journal of Biological , 2005 - ASBMB
     
    7. Structural plasticity associated with the [beta]-propeller architecture
    K Guruprasad, P Dhamayanthi - International journal of biological , 2004 - Elsevier
     
    8. Response to Paoli
    CM Groft, R Beckmann, A Sali, SK Burley - Nature Structural & , 2001 - nature.com
     
    9. The molecular basis of translational control
    CS Fraser - Progress in Molecular Biology and Translational , 2009 - Elsevier
     
    10. The automatic detection of known _-propeller structural motifs from protein tertiary structure
    A Kotu, K Guruprasad - International journal of biological macromolecules, 2005 - Elsevier
     
    11. Structural characterization of ribosomal complexes involved in ribosome biogenesis and protein folding
    M Gartmann - 2010 - edoc.ub.uni-muenchen.de
     
    12. A network-based representation of protein fold space
    S Bliven - 2011 - acsweb.ucsd.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch