The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of a pentameric formate channel. Nat.Struct.Mol.Biol. 17 31-37 2010
    Site NYCOMPS
    PDB Id 3klz Target Id GO.190
    Related PDB Ids 3kly 
    Molecular Characteristics
    Source Vibrio cholerae n16961
    Alias Ids TPS31542,Q9KRE7 Molecular Weight 30553.68 Da.
    Residues 280 Isoelectric Point 8.31
    Sequence mehnqfdsllppqmaeraaitgegkakkaayksfllaisagiqigiafvfytvvttgahdmpygvtkll gglafslglilvvitggelftssvlilvakasgkiswkelvrnwtvvyfgnlcgsiilvfimlatrqfm edggqlglnamaisqhklhhtflqafalglmcnilvclavwmtfsarsltdkvmvlilpvamfvssgfe hcianmfqvpmaigikyfapesfwamtganiaqyadlnfvnfivnnlipvtlgnivgggvfvgmwywli ylkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.50 Rfree 0.223
    Matthews' coefficent 3.16 Rfactor 0.173
    Waters 227 Solvent Content 61.11

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 14;FMT (FORMIC) x 39


    Google Scholar output for 3klz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch