.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gia

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of a na+-independent amino Acid transporter. Science 325 1010-1014 2009
    Site NYCOMPS
    PDB Id 3gia Target Id GO.9411
    Related PDB Ids 3gi8 3gi9 
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS31547, Molecular Weight 47354.76 Da.
    Residues 435 Isoelectric Point 9.26
    Sequence melknkklslweavsmavgvmigasifsifgvgakiagrnlpetfilsgiyallvaysytklgakivsn agpiafihkaigdniitgalsillwmsyvisialfakgfagyflplinapintfniaiteigivaffta lnffgskavgraeffivlvkllilglfifaglitihpsyvipdlapsavsgmifasaifflsymgfgvi tnasehienpkknvpraifisilivmfvyvgvaisaignlpidelikasenalavaakpflgnlgflli sigalfsissamnatiygganvayslakdgelpefferkvwfksteglyitsalgvlfallfnmegvas itsavfmviylfvilshyilidevggrkeivifsfivvlgvfllllyyqwitnrfvfygiiatfigvli feiiyrkvtkrtfsnnmyvks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.32 Rfree 0.23274
    Matthews' coefficent 3.76 Rfactor 0.20254
    Waters 176 Solvent Content 67.28

    Ligand Information
    Ligands D10 (DECANE) x 6;BCN (BICINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gia

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch