.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the MucBP domain of the adhesion protein PEPE_0118 from Pediococcus pentosaceus. Northeast Structural Genomics Consortium target id PtR41A. To be Published
    Site NESGC
    PDB Id 3lyy Target Id PtR41A
    Molecular Characteristics
    Source Pediococcus pentosaceus
    Alias Ids TPS33492,PF06458 Molecular Weight 11489.65 Da.
    Residues 107 Isoelectric Point 3.83
    Sequence thatstetihyvnedgdqvfedgggkldftrtvtiddvtnevveygewtpvtddefaavtspdkdgytp dtsevaaqkpdmtdgpdgtvkdvevtvtytanpavati
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.239
    Matthews' coefficent 2.93 Rfactor 0.194
    Waters 304 Solvent Content 57.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyy
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Crystal structure of the mucin-binding domain of Spr1345 from Streptococcus pneumoniae
    Y Du, YX He, ZY Zhang, YH Yang, WW Shi - Journal of Structural , 2011 - Elsevier
     
    3. Microbial adhesins to gastrointestinal mucus
    N Juge - Trends in Microbiology, 2011 - Elsevier
     
    4. Fold and Function of the InlB B-repeat
    M Ebbes, WM Bleymller, M Cernescu, R Nlker - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch