.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a domain of ribosome-associated factor Y from streptococcus pyogenes serotype M6. Northeast Structural Genomics Consortium target id DR64A. To be Published
    Site NESGC
    PDB Id 3lyv Target Id DR64A
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS33494,BIG_1093 Molecular Weight 6554.08 Da.
    Residues 57 Isoelectric Point 4.72
    Sequence qvvrtknvtlkpmdveearlqmellghdffiytdsedgatnilyrredgnlglieak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.284
    Matthews' coefficent 2.43 Rfactor 0.244
    Waters Solvent Content 49.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyv
    1. Mycobacterium tuberculosis DosR Regulon Gene Rv0079 Encodes a Putative,'Dormancy Associated Translation Inhibitor (DATIN)'
    A Kumar, M Majid, R Kunisch, PS Rani, IA Qureshi - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch