.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target PfR246A. To be Published
    Site NESGC
    PDB Id 3lyu Target Id PfR246A
    Related PDB Ids 3lrx 
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS33471,3.40.50.80 Molecular Weight 15256.09 Da.
    Residues 136 Isoelectric Point 4.97
    Sequence llnvagplgtpvpmekfgkilaigaytgivevypiakawqeigndvttlhvtfepmvilkeelekavtr hivepvplnpnqdflanmknvsqrlkekvrellesedwdlvfmvgpvgdqkqvfevvkeygvpmkvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.237
    Matthews' coefficent 2.08 Rfactor 0.210
    Waters 69 Solvent Content 40.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyu
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch