.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lys

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target KR124F. To be Published
    Site NESGC
    PDB Id 3lys Target Id KR124F
    Molecular Characteristics
    Source Lactococcus lactis
    Alias Ids TPS33470,1.10.150.130 Molecular Weight 12028.18 Da.
    Residues 103 Isoelectric Point 9.27
    Sequence dpikqeiseyfkdwmelykknaidemtykgyeqtlkylktympnvliseitassyqralnkfaethaka stkgfhtrvrasiqplieegrlqkdfttravvkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.290
    Matthews' coefficent 2.93 Rfactor 0.260
    Waters 51 Solvent Content 58.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lys
    1. Flexible nature and specific functions of the HIV-1 nucleocapsid protein
    JL Darlix, J Godet, R Ivanyi-Nagy, P Foss - Journal of molecular , 2011 - Elsevier
     
    2. Biophysical studies of the nucleic acid chaperone properties of the HIV-1 nucleocapsid protein
    J Godet, Y Mly - RNA Biol, 2010 - psychepharmaceuticals.com
     
    3. Inhibition of both HIV-1 reverse transcription and gene expression by a cyclic peptide that binds the Tat-transactivating response element (TAR) RNA
    MS Lalonde, MA Lobritz, A Ratcliff, M Chamanian - PLoS , 2011 - dx.plos.org
     
    4. Structure analysis of membrane-reconstituted subunit c-ring of E. coli H+-ATP synthase by solid-state NMR
    Y Todokoro, M Kobayashi, T Sato, T Kawakami - Journal of biomolecular , 2010 - Springer
     
    5. Initiation of HIV-1 reverse transcription and functional role of nucleocapsid-mediated tRNA/viral genome interactions
    D Sleiman, V Goldschmidt, P Barraud, R Marquet - Virus Research, 2012 - Elsevier
     
    6. The role of Vif oligomerization and RNA chaperone activity in HIV-1 replication
    J Batisse, S Guerrero, S Bernacchi, C Gabus, JL Darlix - Virus Research, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch