.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lrq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title E3 UBIQUITIN-PROTEIN LIGASE RING DOMAIN FROM HUMAN TRIPARTITE MOTIF-CONTAINING PROTEIN 37 (TRIM37), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D. To be Published
    Site NESGC
    PDB Id 3lrq Target Id HR4604D
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS33495,3.30.40.10 Molecular Weight 9616.73 Da.
    Residues 81 Isoelectric Point 6.69
    Sequence mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplqlrelvncrwa eevtqqldtlql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.29 Rfree 0.2449
    Matthews' coefficent 2.28 Rfactor 0.1897
    Waters 106 Solvent Content 45.98

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 3lrq
    1. Symmetry and asymmetry of the RING-RING dimer of Rad18
    A Huang, RG Hibbert, RN de Jong, D Das - Journal of molecular , 2011 - Elsevier
     
    2. Solution Structure of RING Finger-like Domain of Retinoblastoma-binding Protein-6 (RBBP6) Suggests It Functions as a U-box
    MA Kappo, AB Eiso, F Hassem, RA Atkinson - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch