.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lmo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target RpR324. To be Published
    Site NESGC
    PDB Id 3lmo Target Id RpR324
    Related PDB Ids 2kw2 
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS31804,PF00550, 16805, 1.10.1200.10 Molecular Weight 10228.00 Da.
    Residues 93 Isoelectric Point 4.39
    Sequence mtstfdrvatiiaetcdipretitpeshaiddlgidsldfldiafaidkafgiklplekwtqevndgka tteqyfvlknlaaridelvaakga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.254
    Matthews' coefficent 3.02 Rfactor 0.216
    Waters 92 Solvent Content 59.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lmo
    1. Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long chain fatty acids in open and closed conformations
    TA Ramelot, P Rossi, F Forouhar, HW Lee, Y Yang - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch