.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target LkR115. To be Published
    Site NESGC
    PDB Id 3lml Target Id LkR115
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31769,PF04984 Molecular Weight 49092.40 Da.
    Residues 452 Isoelectric Point 4.85
    Sequence mvsggtfnagvekirpgiytnfkaaaaertkagergtvalplaaswgaakefveinkeedvekklglsl ahqsflllretlklaktvlvyrlndgikatatlatdvvvtakyggivgnsitikvdenvvdsskkdvtt ylnevavdkqvvgtaselidsnyvsfkttstselqqssgttlvggtdqpvtnldytqflvsaegeyfdt iafpvsssdvalktsfvsfvkrmrdeqgvkikgvvanmpadyegiinvrngvtlrdgtilephqvvawv agadasasmlksntfvkydgaidatprlandeaeealqngefvltfdardkavyveqdlnslttfskek sskfrknkisrildginndtrrnildaikerkdantdipadengvqfilsmqtaylnelqdsgaitnfd staditvslnnnvdgfivnqsiepvdsgekfyfttevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.30 Rfree 0.260
    Matthews' coefficent 2.52 Rfactor 0.230
    Waters Solvent Content 51.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lml
    1. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    2. Structural Conservation of the Myoviridae Phage Tail Sheath Protein Fold
    AA Aksyuk, LP Kurochkina, A Fokine, F Forouhar - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch