The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target MuR16. To be published
    Site NESGC
    PDB Id 3lmc Target Id MuR16
    Molecular Characteristics
    Source Methanocorpusculum labreanum (strain z)
    Alias Ids TPS31827,PF07998, 3.40.390.10 Molecular Weight 23177.48 Da.
    Residues 202 Isoelectric Point 5.48
    Sequence mgihlfwdsrvpvglsrpvseelsavlempvsriddgifplegfdpvrnqydavkvllkldmfrrrmpq ifkpadmdlefynkfnhlhekillvtpgdlyepladfvfglaypklgvaivsphrlqnefygkyaddsa lidrivkegaheighlfglghcdnpgcimycprnldeldrkrkyfcgkcrvqlngdtleddlfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.258
    Matthews' coefficent 2.61 Rfactor 0.212
    Waters 98 Solvent Content 52.83

    Ligand Information
    Metals ZN (ZINC) x 1;FE (FE) x 1


    Google Scholar output for 3lmc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch