.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lkd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SuR80. To be published
    Site NESGC
    PDB Id 3lkd Target Id SuR80
    Molecular Characteristics
    Source Streptococcus thermophilus
    Alias Ids TPS33450,3.40.50.150, PF12161, PF02384, BIG_308, PF07669 Molecular Weight 60266.53 Da.
    Residues 534 Isoelectric Point 4.60
    Sequence msettqtsqslyqalwnsadvlrskmdandyksyllgmvfykylsdkmlffvaetmeeetesldealav yrkyyedeethedllavitdemsyaihpdltftalvervndgsfqledlaqgfrdieqsdelyenlfed idlyskklgatpqkqnqtvaavmkelavldvaghagdmlgdayeyligqfatdsgkkagefytpqpvak lmtqiaflgredkqgftlydatmgsgslllnakrysrqpqtvvyfgqelntstynlarmnmilhgvpie nqflhnadtldedwptqeptnfdgvlmnppysakwsassgfmddprfspfgklapkskadfafllhgyy hlkqdngvmaivlphgvlfrgnaegtirkalleegaidtviglpaniffntsipttviilkknrtnrdv yfidaskefdkgknqnimtdahiekilnayksredidkfahlasfeeivendynlnipryvdtfeeeev eplteivakinqtnatiesqtaslldmlgqlhgttpeadeelkafvkafkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.210
    Matthews' coefficent 1.95 Rfactor 0.186
    Waters 431 Solvent Content 36.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lkd
    1. Characterization and crystal structure of the type IIG restriction endonuclease RM. BpuSI
    BW Shen, D Xu, SH Chan, Y Zheng, Z Zhu - Nucleic acids , 2011 - Oxford Univ Press
     
    2. Structure and operation of the DNA-translocating type I DNA restriction enzymes
    CK Kennaway, JE Taylor, CF Song - Genes & , 2012 - genesdev.cshlp.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch