.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l8m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a probable thiamine pyrophosphokinase from Staphylococcus saprophyticus subsp. saprophyticus. Northeast Structural Genomics Consortium target id SyR86. To be Published
    Site NESGC
    PDB Id 3l8m Target Id SyR86
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS31762,3.40.50.10240, PF04265, PF04263, 2.60.120.320 Molecular Weight 23880.93 Da.
    Residues 211 Isoelectric Point 5.26
    Sequence mkanllcgnrnlpkhilvehkhehwigidrgtlillesgitpqfavgdfdsisdsernfiqqqieinpy nsekddtdlalgidqavkrgyrnidvygatggrldhfmgalqilekpeyakmninikliddtneiqfiq kgqfnvtyseqfpyisfipviyptvislkgfkynlqnetlklgstltisnelsqscgnieiiegsvlmi rskd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.271
    Matthews' coefficent 2.72 Rfactor 0.238
    Waters 96 Solvent Content 54.81

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 3l8m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch