.
The Open Protein Structure Annotation Network
PDB Keyword
.

3klw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of primosomal replication protein n from Bordetella pertussis. northeast structural genomics consortium target ber132. To be Published
    Site NESGC
    PDB Id 3klw Target Id BeR132
    Molecular Characteristics
    Source Bordetella pertussis
    Alias Ids TPS33434,2.40.50.140 Molecular Weight 11423.73 Da.
    Residues 107 Isoelectric Point 6.40
    Sequence mntlelsarvlecgamrhtpaglpalelllvhesevveaghprrveltisavalgdlallladtplgte mqvqgflaparkdsvkvklhlqqarriagsmgrdplvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.267
    Matthews' coefficent 2.87 Rfactor 0.232
    Waters 63 Solvent Content 57.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3klw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch