The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target GR157. To be Published
    Site NESGC
    PDB Id 3kb1 Target Id GR157
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS31748,PF10609, PF01656,, PF02374, BIG_766 Molecular Weight 28030.10 Da.
    Residues 254 Isoelectric Point 5.20
    Sequence mqkrvtdedikerldkigfriavmsgkggvgkstvtallavhyakqgkkvgildadflgpsiphlfgle kgkvavsdeglepvltqrlgikvmsiqfllpkretpviwrgpliagmireflgrvawgeldyllidlpp gtgdapltvmqdakpngavivstpqeltaavvekaitmaeqtktavlgivenmayfecpncgertylfg egkaselarkykiefiteipidsdllklsdlgrveeyepdwfeffpy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.265
    Matthews' coefficent 2.35 Rfactor 0.214
    Waters 38 Solvent Content 47.56

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 3kb1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch