The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target PaR198. To be Published
    Site NESGC
    PDB Id 3kaw Target Id PaR198
    Related PDB Ids 3kav 
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS31749,PF03860, BIG_720 Molecular Weight 14218.16 Da.
    Residues 132 Isoelectric Point 4.86
    Sequence mtraindpgnedpgslletdadallggaaaqapeercrlaaqaciracerylalctessreqrqhagdc adlcrlaalllerrspwapaacelaaryalacaercdgdeplerecagacrrfveacrpllpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.260
    Matthews' coefficent 2.18 Rfactor 0.200
    Waters 155 Solvent Content 43.64

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 3kaw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch