.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ka7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an oxidoreductase from Methanosarcina mazei. To be Published
    Site NESGC
    PDB Id 3ka7 Target Id MaR208
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS31755,3.50.50.60, 3.40.50.720, PF01593 Molecular Weight 45572.81 Da.
    Residues 425 Isoelectric Point 5.51
    Sequence mktvvigaglggllsaarlskaghevevferlpitggrftnlsykgfqlssgafhmlpngpggplacfl keveasvnivrsemttvrvplkkgnpdyvkgfkdisfndfpsllsykdrmkiallivstrknrpsgssl qawiksqvsdewlikfadsfcgwalslksdevpveevfeiienmyrfggtgipeggckgiidaletvis anggkihtgqevskiliengkaagiiaddrihdadlvisnlghaatavlcsealskeadaayfkmvgtl qpsagikiclaadeplvghtgvlltpytrringvnevtqadpelappgkhltmchqyvapenvknlese iemgledlkeifpgkryevlliqsyhdewpvnraasgtdpgnetpfsglyvvgdgakgkggievegval gvmsvmekvlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.22329
    Matthews' coefficent 2.43 Rfactor 0.19361
    Waters 362 Solvent Content 49.48

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ka7
    1. On the Structure and Function of the Phytoene Desaturase CRTI from Pantoea ananatis, a Membrane-Peripheral and FAD-Dependent Oxidase/Isomerase
    P Schaub, Q Yu, S Gemmecker - PloS one, 2012 - dx.plos.org
     
    2. On the Structure and Function of the Phytoene Desaturase CRTI from
    P Schaub, Q Yu, S Gemmecker - 2012 - biomedsearch.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch