The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein lp_0118 from Lactobacillus plantarum,northeast structural genomics consortium target LpR91B. To be Published
    Site NESGC
    PDB Id 3k2y Target Id LpR91B
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS31820,BIG_1053, PF08797 Molecular Weight 11396.41 Da.
    Residues 101 Isoelectric Point 5.09
    Sequence tgdaavaldtvtvvgeryvddivatlttlrvgmavllqresgnqyddnaisvwtlqhaklgyiaryqnq pyatlmdqgqrlygivtvldqqkqhlelmlwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.271
    Matthews' coefficent 2.45 Rfactor 0.229
    Waters 150 Solvent Content 49.76

    Ligand Information


    Google Scholar output for 3k2y

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch