The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Pyrophosphate-dependent phosphofructokinase from Marinobacter aquaeolei, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET MqR88. To be Published
    Site NESGC
    PDB Id 3k2q Target Id MqR88
    Molecular Characteristics
    Source Marinobacter aquaeolei
    Alias Ids TPS31788,, PF00365, Molecular Weight 45758.47 Da.
    Residues 420 Isoelectric Point 5.75
    Sequence maiknafyaqsggvtavinasacgviqtarkhpdqigkvyagrngiigalkeelidtslesddaiqali htpggafgscryklknisenqreyerlievfrahdigyffyngggdsqdtaykvsqladrmgypitcig vpktvdndlpftdccpgfgsvakyiatstleasldiksmcetstkvfilevmgrhagwiaaagglagqs egepphvilfpeipfnrekflervdqcvrdygycvvvasegaqyedgrfvadagakdafghtqlggvap alanmvkqalghkyhwavadylqraarhiasatdveqayavgkaavemalagkqalmptivrdqakpyr wsigeanlsevanqekkmpihyitdngfgitqdcrdylqpliagesfppfddglprvaklknqlvekkl rtefel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.260
    Matthews' coefficent 2.64 Rfactor 0.234
    Waters 364 Solvent Content 53.50

    Ligand Information
    Metals NA (SODIUM) x 3


    Google Scholar output for 3k2q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch