The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SgR112. To be published
    Site NESGC
    PDB Id 3k25 Target Id SgR112
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS31772,, PF01263 Molecular Weight 33027.41 Da.
    Residues 289 Isoelectric Point 5.27
    Sequence mynisftpdrpltyhleddqslarlslvpgrgglvtewtvqgqpilyfdrerfqdpslsvrggipilfp icgnlpqdqfnhagksyrlkqhgfardlpwevigqqtqdnarldlrlshndatleafpfafelvfsyql qghslrieqrianlgdqrmpfslgfhpyffcreklgitlaipandyldqktgdchgydgqlnltspeld laftqisqprahfidpdrnlkievsfselyqtlvlwtvagkdylclepwsgprnalnsgeqlawvepys srsawvnfqvste
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.2439
    Matthews' coefficent 2.81 Rfactor 0.2326
    Waters 12 Solvent Content 56.25

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3


    Google Scholar output for 3k25

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch