.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Lipoprotein_17 domain from Q9PRA0_UREPA protein of Ureaplasma parvum. To be Published
    Site NESGC
    PDB Id 3jvc Target Id UuR17A
    Related PDB Ids 2krt 3k63 
    Molecular Characteristics
    Source Ureaplasma parvum
    Alias Ids TPS31809,PF04200, 16648 Molecular Weight 11863.87 Da.
    Residues 101 Isoelectric Point 8.74
    Sequence vnnirlkdtfdfklaafpnqnydqllpsqiyknyyqgieiqqhkyqneldikiinflypdgdfgsankn gtlklslmltdkknnqvyykllevsgfksnpy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.69 Rfree 0.247
    Matthews' coefficent 2.35 Rfactor 0.230
    Waters 40 Solvent Content 47.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3jvc
    1. Solution NMR and X-ray crystal structures of membrane-associated Lipoprotein-17 domain reveal a novel fold
    R Mani, S Vorobiev, GVT Swapna, H Neely - Journal of Structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch