The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of All0216 protein from Nostoc sp. PCC 7120 at the resolution 1.8A. To be Published
    Site NESGC
    PDB Id 3jsr Target Id NsR236
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS31750,BIG_1290, PF10674 Molecular Weight 12818.01 Da.
    Residues 111 Isoelectric Point 5.16
    Sequence mkmqtyyyvlasrrfllqeepieevlkertrhyheqekeidfwlvpqpafleapefadikakcpqpaaa iistnsqfitwlklrleyvvtgefsapsetipnplaslatas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.226
    Matthews' coefficent 2.89 Rfactor 0.222
    Waters 135 Solvent Content 61.50

    Ligand Information
    Metals K (POTASSIUM) x 1


    Google Scholar output for 3jsr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch