.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ilm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Alr3790 protein from Anabaena sp. To be Published
    Site NESGC
    PDB Id 3ilm Target Id NsR437H
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS31797,3.40.250.10, PF00581 Molecular Weight 14446.28 Da.
    Residues 132 Isoelectric Point 5.01
    Sequence sdahvlksrlewgepaftildvrdrstyndghimgamampiedlvdrasssleksrdiyvygagdeqts qavnllrsagfehvselkgglaawkaiggptegiiesrtpagaddynvvsrmqnhlenqkkev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.26 Rfree 0.2452
    Matthews' coefficent 2.03 Rfactor 0.2320
    Waters 149 Solvent Content 39.53

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 5

    Jmol

     
    Google Scholar output for 3ilm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch