.
The Open Protein Structure Annotation Network
PDB Keyword
.

3idu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target PfR193A. To be Published
    Site NESGC
    PDB Id 3idu Target Id PfR193A
    Related PDB Ids 2kl6 
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS28415,PF07705, 16385 Molecular Weight 11053.98 Da.
    Residues 99 Isoelectric Point 4.89
    Sequence fpdltveikgpdvvgvnklaeyevhvknlggigvpstkvrvyingtlyknwtvslgpkeekvltfnwtp tqegmyrinatvdeentvvelnennnvatf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.212
    Matthews' coefficent Rfactor 0.190
    Waters 209 Solvent Content 31.65

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 4

    Jmol

     
    Google Scholar output for 3idu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch